PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Traes_3AL_FC5523394.2
Common NameABFB
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Triticum
Family bZIP
Protein Properties Length: 122aa    MW: 14006.1 Da    PI: 10.0084
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Traes_3AL_FC5523394.2genomeIWGSCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_1439.7e-143891558
                           CHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
                 bZIP_1  5 krerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkkevak 58
                           +r rr++kNRe+A rsR+RK+a++ eLe +   L++eN +Lk e +++  + ++
  Traes_3AL_FC5523394.2 38 RRHRRMIKNRESAARSRARKQAYTVELEAELNHLKEENARLKAEEKTILLTKKQ 91
                           689***************************************997776555555 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003384.8E-123398IPR004827Basic-leucine zipper domain
PROSITE profilePS5021710.8523681IPR004827Basic-leucine zipper domain
Gene3DG3DSA:1.20.5.1702.7E-143885No hitNo description
CDDcd147073.79E-193892No hitNo description
SuperFamilySSF579591.97E-113884No hitNo description
PfamPF001702.7E-113890IPR004827Basic-leucine zipper domain
PROSITE patternPS0003604156IPR004827Basic-leucine zipper domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 122 aa     Download sequence    Send to blast
MTQADMMNCM GEGAMMENGG TRKRGAPEDQ SCERSIERRH RRMIKNRESA ARSRARKQAY  60
TVELEAELNH LKEENARLKA EEKTILLTKK QMLVEKMIEQ SKENVNAKKG APLSRHCGSC  120
IW
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAF5198040.0AF519804.1 Triticum aestivum ABA response element binding factor (ABFB) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004970655.11e-56PREDICTED: protein ABSCISIC ACID-INSENSITIVE 5 isoform X1
SwissprotQ9SJN01e-21ABI5_ARATH; Protein ABSCISIC ACID-INSENSITIVE 5
TrEMBLW5CIB05e-85W5CIB0_WHEAT; Uncharacterized protein
TrEMBLQ8LK781e-83Q8LK78_WHEAT; ABA response element binding factor
STRINGMLOC_34679.14e-73(Hordeum vulgare)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP38303558
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G36270.18e-23bZIP family protein
Publications ? help Back to Top
  1. Johnson RR,Wagner RL,Verhey SD,Walker-Simmons MK
    The abscisic acid-responsive kinase PKABA1 interacts with a seed-specific abscisic acid response element-binding factor, TaABF, and phosphorylates TaABF peptide sequences.
    Plant Physiol., 2002. 130(2): p. 837-46
    [PMID:12376648]